Best Privacy Screen For Macbook Pro 13 Inch In May 2025

Facebook

Twitter

Tumblr

Pinterest

Reddit

WhatsApp

Telegram

To help you choose the Best Privacy Screen For Macbook Pro 13 Inch, we’ve put together this comprehensive guide. We have tried to cover as much variety as possible. Hope you will find it helpful!

To help you in your search, we have completed this list of the Best Privacy Screen For Macbook Pro 13 Inch.

Top Rated Best Privacy Screen For Macbook Pro 13 Inch Of 2025

Rank	Product Name	Score
1	Easy On/Off Magnetic Privacy Screen Filter for Macbook Pro 13.3 Inch 2016,2017,2018,2019 including Buy Now	9.7 Buy Now
2	Kensington MP13 MacBook Magnetic Privacy Screen for 13" 2016/17/18/19 MacBook Pro and 2018 Buy Now	9.5 Buy Now
3	Homy Privacy Screen Protector Kit for MacBook Pro 13 inch 2016-2020, MacBook Air Buy Now	9.1 Buy Now
4	Ceydebne Magnetic Privacy Screen for MacBook Pro 13 Inch 2012 Early 2015,Anti-Glare, Blocks Buy Now	8.8 Buy Now
5	SightPro Magnetic Privacy Screen for MacBook Pro 13 Inch (2016, 2017, 2018, 2019) Buy Now	8.6 Buy Now
6	Magnetic Privacy Laptop Screen Filter for MacBook Pro 13” and 2018 MacBook Air Buy Now	8.3 Buy Now
7	SightPro Easy On/Off Privacy Screen for MacBook Pro 13 Inch Buy Now	8.1 Buy Now
8	Solitude Screens Magnetic Privacy Screen MacBook Pro 13 inch-Slimmest on Market-Closes Fully Dual-Sided Buy Now	7.8 Buy Now
9	for MacBook Pro 13 inch New Removable HD Privacy Screen Protector Filters, Bubble Buy Now	7.5 Buy Now
10	YAKAI 13 inch [Magnetic] Privacy Filter Screen Protector, Anti-spy&Anti-Glare Film Compatible MacBook Pro Buy Now	7.2 Buy Now

1. Easy On/Off Magnetic Privacy Screen Filter for Macbook Pro 13.3 Inch 2016,2017,2018,2019 including

• Magnetic privacy screen macbook ppro 13 inch- no adhesives needed. filter must be removed to fully close laptop -- computer will still sleep if left on. to ensure you are selecting the correct privacy screen, check the size and model of your mac
• 20% brighter than competitive solutions - our privacy filters are brighter and clearer than other solutions and therefore ideally suited for today's high-resolution laptops and monitors.
• Privacy screen macbook pro 13 inch- while people directly in front of the screen have a perfectly clear view, the view for those outside the 60 viewing angle is blocked to ensure privacy and security.
• Privacy screen geckocare computer privacy screen filter is perfect for public and high traffic areas. it uses revolutionary micro-louver technology. anti-glare and anti scratch
• Fits apple macbook pro 13" (late 2016 to 2019) & macbook air (2019+) - diagonal: 13" inches / width: 299mm / height: 195mm. compare your screen size against and model. contact us in case of doubt.

2. Kensington MP13 MacBook Magnetic Privacy Screen for 13" 2016/17/18/19 MacBook Pro and 2018

• Limits viewing angle to +/- 30 degrees, hiding personal or confidential information from anyone trying to look from the side, taa compliant
• 2 year and lifetime technical support, only valid if purchased from the kensington usa store on , or from directly. no other resellers on are authorized to sell kensington products on .
• Reversible with matte and glossy viewing options, reduces harmful blue light by up to 22%, includes cleaning cloth and screen holder to keep your privacy screen clean and protected from scratches while not in use
• Note: because this privacy screen attaches with magnets versus sticking to the macbook screen, the lid of the laptop may have a slight gap when closed with the privacy screen attached, but the macbook will still go to sleep and/or turn of the screen if that functionality is enabled
• Macbook privacy screen filter integrates seamlessly with your 2016, 2017, 2018 or 2019 macbook pro and 2018 and 2020 macbook air by attaching to magnets that are already built in to the macbook's frame, watch the video to the left to learn more.

3. Homy Privacy Screen Protector Kit for MacBook Pro 13 inch 2016-2020, MacBook Air

• Eyes and screen protection. 5h hardness durable design. protects your screen from daily scratches, dust and scrapes. reduce up to 30% of negative blue light and 90% of uv light.
• Free gifts: 1) an excellent keyboard cover made of ultra-thin 0.12 mm clear tpu case. completely washable and reusable. regular price $12.99. 2) hard plastic folder to store your filter when not in use.
• Easy application. follow the included application manual/tips and you will get a perfect effect. no residue left: no residue is left on your lcd/led display when you remove it.
• Superior privacy. you will see your screen clearly, while visual hackers are left in the dark. stop giving access to your confidential information to everyone around you outside the 60 degree viewing angle. make it easy for you to work in public places, and keep your information private.
• Limited lifetime warranty. we make sure you get the best quality from private screen protectors customer service. we are ready to help you 24 hours per day (around the clock) (our customer service is available 27/7). any questions? - please feel free to contact us

4. Ceydebne Magnetic Privacy Screen for MacBook Pro 13 Inch 2012 Early 2015,Anti-Glare, Blocks

• Because this privacy screen macbook pro 13 attaches with magnets versus sticking to the macbook screen, the lid of the laptop may have a slight gap when closed with the privacy screen attached, but the macbook will still go to sleep and/or turn of the screen if that functionality is enabled
• Simply place the macbook pro 13 privacy screen along the top of your macbook and let the magnets attach along the top. no need for tricky placement, messy tape, or damaging adhesive. easily remove and reattach when you need it.
• No-hassle warranty provides easy lifetime protection for your privacy screen for macbook pro 13 inch.
• Limits viewing angle to +/- 30 degrees, hiding personal or confidential information from anyone trying to look from the side,privacy screen helps keep screen information safe from prying eyes, ideal when flying, commuting, or working in a cafe or other public space
• The privacy screen for macbook pro 13 inch reduces harsh blue light for less eye strain, protects against dust and scratches, easily attaches with magnetic snap-on design, matte finish reduces unwanted glare and reflection

5. SightPro Magnetic Privacy Screen for MacBook Pro 13 Inch (2016, 2017, 2018, 2019)

• Perfect for travel and open workspaces - the mac book pro privacy screen filter is the ideal solution for healthcare providers, mobile workers, commuters, students, and business travelers. now you can stay compliant and safeguard sensitive corporate information while working in airplanes, subways, airports, and public areas.
• Superior privacy and anti glare - our advanced multi-layered film filter blacks out your screen when viewing from the side, while maintaining a crystal clear screen straight-on. it also protects your eyes from harmful glare, uv, and blue light. note: it does not block visibility directly behind you, regardless of the distance.
• Package contents - each package includes one magnetic privacy screen filter and a microfiber cleaning cloth. buy with confidence located in the us (w9 available on request), sightpro specializes in providing best-in-class privacy solutions to individuals, small businesses, corporations, government, and educational institutions. our privacy screens are taa compliant.
• Instant snap-on magnetic attachment: simply place the privacy screen along the top of your macbook and let the magnets attach along the top. no need for tricky placement, messy tape, or damaging adhesive. easily remove and reattach when you need it. please note, when the privacy screen is attached, your laptop will not close completely, but the sleep mode is still suppo...
• Perfect fit for 13" macbook pro touch bar, thunderbolt 3 ports: the sightpro magnetic privacy screen is designed to integrate seamlessly with your macbook pro 13 inch year 2016, 2017, 2018, 2019. (model: a1708, a1706, a1989, a2159)

6. Magnetic Privacy Laptop Screen Filter for MacBook Pro 13” and 2018 MacBook Air

• Superior magnetic privacy this magnetic screen privacy filter is the ideal solution for for open office settings, universities, financial institutions, health care providers, and corporate travel. it is also helps keep your screen safe from dust and scratches.
• Built in webcam cover when your macbook pro is not in use, mac cover webcam prevents web hackers from spying on you.privacy monitor protects your security and privacy, prevent anyone from watching or recording you through your web camera(s).
• What you get package include magnetic privacy laptop screen filter x 1, gift cleaning cloth x1, washable silicone stickers x 8 , portable carrying case x 1.
• Keep your eyes & screen safe advanced privacy technology our advanced multi-layered film filter blacks out your screen when viewing from the side, while maintaining a crystal clear screen straight-on. it also protects your eyes from harmful glare, uv, and blue light.
• Compatibility this magnetic privacy screenfilter fits for macbook pro 13 inch late 2016-current model and 2018 macbook air. please make sure that your screen size fits this screen protector before purchasing it.

7. SightPro Easy On/Off Privacy Screen for MacBook Pro 13 Inch

• Secure fit for 13" macbook pro retina: the sightpro easy on/off privacy screen is designed to integrate seamlessly with your macbook pro 13 inch year 2012, 2013, 2014, 2015. (model: a1278, a1425, a1502)
• Superior privacy and anti glare: our advanced multi-layered film filter blacks out your screen when viewing from the sides, while maintaining a crystal clear screen straight-on. it also shields your eyes from harmful glare, uv, and blue light. note: it does not block visibility directly behind you, regardless of the distance.
• Buy with confidence: located in the us (w9 available on request), sightpro specializes in providing best-in-class privacy solutions to individuals, small businesses, corporations, government, and educational institutions. our privacy screens are taa compliant.
• Built-in reusable adhesive frame: no messy tape needed! the easy to attach adhesive frame ensures a secure 360 fit and unlike the magnetic ones, it will not detach, even when your screen is leaned forward. simply attach, remove, and reattach when you need it.
• Screen protector: the 9h hardness material will protect your mac book display from scratches and unsightly oil marks often left by your keyboard. note: when the privacy screen is affixed to your display, your macbook will not close completely, but the sleep mode is still supported.

8. Solitude Screens Magnetic Privacy Screen MacBook Pro 13 inch-Slimmest on Market-Closes Fully

• Keep your screen private with solitude screens your work, personal finances, and amazing ideas will never be more secure from prying eyes at airports, coffee shops, airplanes, offices, and other remote public work areas than with our premium privacy filter. fits all macbook pro 13" models 2016-2020, and macbook air with retina display 13" years 2019 and 2020 only.
• Extremely thin and private laptop sits completely flush when closed to support sleep mode. 60% viewing angle to provide practical privacy.
• Easily attach & remove with magnetic attachment the solitude screen privacy filter was designed by remote workers for those who are always on the go. its easy to use when you are out in public, and easy to remove when you get to your home or hotel room.
• Happiness guaranteed solitude screens is a small business that designs all of our products in the usa. we hope you enjoy our products, but if youre not 100% satisfied, we offer easy returns and a money-back guarantee
• Protect your eyes & improve screen visibility our premium screen reduces harsh blue light to protect your eyes, and also reduces glare and reflections to make your screen easier to view anywhere

9. for MacBook Pro 13 inch New Removable HD Privacy Screen Protector Filters, Bubble

• 3.accessories filmext package comes a large size premium microfiber cloth for cleaning your screen, an ultra-thin keyboard film, a white backer works as the storage in good condition when the filter is not in use, you can put back on this backer and reuse onto your screen.
• 2.performance filmextmacbookprivacyangleis305,youcanclearlyreadthedatafromthefrontsidebutitisadarkscreenwhenviewingfromtheside,blocks35% bluelightandprotectsyoureyes,withanti-scratchcoatingandpreventsscratchingfromdailyuse.
• 5.tips privacy effect: strong light environment and low screen brightness show the best privacy features (the stronger light environment, the better privacy). it shows the best privacy around brightness 75% if it is dark environment around you. if you have any questions about the installation or the product, please feel free to contact us, we will try our bes...
• 4.application filmextprivacyscreenprotectorisworkableforallkindsofpublicplaces,businessmeetings,openoffices,financialinstitutions,cafes,airplanes,trains, etc.,toprotectyoursensitiveinformation,passwords,personalcontent,etc.oranyinformationmaybeleaked.
• 1.feature filmextprivacyscreenfilterperfectlyfitmacbook,compatible 2018 macbook air 13.3(a1932) and macbook pro 13.3 2016, 2017 2018 2019 touch bar and non-touch bar(a1706/a1708) latestresearchanddevelopmentprivacyfilterwithhighclarity,itshowsthesameresolutionviewingfrom thefrontside(notdarker),feelscomfortableandnon-eyestrai...

10. YAKAI 13 inch [Magnetic] Privacy Filter Screen Protector, Anti-spy&Anti-Glare Film Compatible

• Doubles as screen & eye protector privacy screen for monitors not only provides privacy but also protects your eyes by filtering out 97% uv and curbing blue light by 70%, which can otherwise have an adverse impact on your eyes. our privacy screen also helps keep your screen safe from dust and scratches.
• Maximum privacy effective "black out" privacy from side views outside the 60-degree viewing angle. designed for optical clarity when viewing from the front, a person not at the front of the screen can only see the dark side of the screen, so it protects buisness secrets and personal privacy. however, it is not designed for touchscreens.
• Magnetic strip for easy installation & removalm the magnet filter integrates seamlessly with your mac, allowing it to be magnetically attached onto your screen and easily removed at any time.
• No more prying eyes we produce it from premium korean (lg) materials. the privacy effect more dark and the front side more clarity than normal filter. best for public and high traffic areas, airplane, airport, bus, offices, and for financial / health care providers. *note: according to the privacy filter manufacturing protocol, during the different environment, pleas...
• Specifically designed for macbook pro 13'', aslo call 13.3'' (2016~2018 models only). this privacy screen protector fit generation 2016~2018: a1706/a1708/a1989 models.